PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015883178.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 607aa    MW: 68769.2 Da    PI: 4.9146
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015883178.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS304.23e-932336041374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykal..ppsetseknsseelaalkl.fsevsPilk 92 
                     lvelLl++Ae v+ +++e+a +lL++   l++++g+p+qR++ yf eAL++++ r++ ++ ++   +  + + ++   +++ +kl ++   P+ +
  XP_015883178.1 233 LVELLLAAAEKVDYQQFERAGKLLNQCDSLSNNTGNPVQRVIYYFSEALRQKIDRETGRITSKGieEKIPFDIEEAMMNMSTTKLaYHMRLPFSQ 327
                     689****************************************************666665554233334444445555555555788889**** PP

            GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrl 186
                     + +++  qaI e v +++++H+iDf+i +G++W aL+qaLasR+  +  +l+iT+v+    +sk+ +e+tg+ L +fA+++++pf+f++++++++
  XP_015883178.1 328 VVQFAGTQAIIENVGEARKIHVIDFGIRNGVHWTALMQALASRSeYPLERLKITAVVT---KSKHLIENTGQTLVSFAQTMNIPFSFKIVLVSDM 419
                     ********************************************55667*********...58999***************************** PP

            GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpresee 281
                      dl+ + ++++  EalaV++ ++l  + +++ +les    v++++++l+P vvvv+e e++hns+ F++rf+e l +y a fd+++a + r++ +
  XP_015883178.1 420 VDLKEDLFELDAAEALAVHSKFSLWGMISQPNQLES----VMRVIRNLKPCVVVVAEVESNHNSPVFVKRFIEGLFFYGANFDCFDAFMKRDDPN 510
                     ****************************99999988....******************************************************* PP

            GRAS 282 rikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     r+ +E +l+g  i+n+va+eg+er+ rh +   Wr+ ++++G+++ +ls++   qa+l++++++ ++  +++++ +sl++gWk+ pL s+S+W+
  XP_015883178.1 511 RMIIESKLFGYGIRNMVATEGEERKTRHVKIDVWRAFFSRFGLEEEELSSSSLYQANLVVKNFPhGNSCTLDKNGKSLLIGWKGTPLQSLSVWK 604
                     ****************************************************************9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.648207583IPR005202Transcription factor GRAS
PfamPF035141.0E-90233604IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 607 aa     Download sequence    Send to blast
MRAQKLIIFA FCQMEDSMFY LADLSFGVVQ EKFVSADSYL DGMKNVRSYG GEDWDYSGNT  60
DSHFPEHFFY NDDSVMEGCV FSKFELQEDK KVSSSEYGLL DDVQFDVVSP PLHRCIEEIS  120
KLDEIQNPIP KVEAAKKEKG KPFPLAGLEL LNNYGSGFKR LNGERIVEPS NNEIACAKDD  180
EGRELSTEEI VRIAGTRFIQ SSSQEVDVAS MVNHPFESSF SGLSDEDIKD VELVELLLAA  240
AEKVDYQQFE RAGKLLNQCD SLSNNTGNPV QRVIYYFSEA LRQKIDRETG RITSKGIEEK  300
IPFDIEEAMM NMSTTKLAYH MRLPFSQVVQ FAGTQAIIEN VGEARKIHVI DFGIRNGVHW  360
TALMQALASR SEYPLERLKI TAVVTKSKHL IENTGQTLVS FAQTMNIPFS FKIVLVSDMV  420
DLKEDLFELD AAEALAVHSK FSLWGMISQP NQLESVMRVI RNLKPCVVVV AEVESNHNSP  480
VFVKRFIEGL FFYGANFDCF DAFMKRDDPN RMIIESKLFG YGIRNMVATE GEERKTRHVK  540
IDVWRAFFSR FGLEEEELSS SSLYQANLVV KNFPHGNSCT LDKNGKSLLI GWKGTPLQSL  600
SVWKFLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-4525260422375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015883178.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLM5XKD70.0M5XKD7_PRUPE; Uncharacterized protein
STRINGPOPTR_0010s15370.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.12e-43RGA-like 2